stata version 13 (STATA Corporation)
STATA Corporation is a verified supplier 
99
Structured Review
STATA Corporation
stata version 13
Stata Version 13, supplied by STATA Corporation, used in various techniques. Bioz Stars score: 99/100, based on 33854 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/stata+version+13+0/STATA+13%2E0/pmc12966693-123-6-6
Average 99 stars, based on 33854 article reviews
Stata Version 13, supplied by STATA Corporation, used in various techniques. Bioz Stars score: 99/100, based on 33854 PubMed citations. ZERO BIAS - scores, article reviews, protocol conditions and more
https://www.bioz.com/product/stata+version+13+0/STATA+13%2E0/pmc12966693-123-6-6
Average 99 stars, based on 33854 article reviews
stata version 13 - by Bioz Stars,
2026-09
99/100 stars
Images
Related Articles
other:Article Title: Drug-Induced Hyponatremia as a Cause of Emergency Department Attendance. Article Snippet: Statistical analysis was performed using Article Title: Distribution of adverse pathological features and prognosis across tongue, buccal, gum, and other oral cancer subsites: A nationwide study. Article Snippet: All statistical analyses were conducted using Article Title: Drug-Induced Hyponatremia as a Cause of Emergency Department Attendance Article Snippet: Statistical analysis was performed using Article Title: Diagnostic accuracy of short-incubation cultures versus standard protocols for bacterial identification and susceptibility testing via VITEK® MS and VITEK®2 XL. Article Snippet: Background: Sepsis is a medical emergency associated with high morbidity and mortality rates.. Rapid pathogen identification and early antimicrobial susceptibility results are essential for optimizing treatment.. Conventional protocols require at least 24 h, delaying clinical decision-making. Article Title: The APOE paradox: divergent genetic influences on hemorrhagic stroke risk—A meta-analysis Article Snippet: Pooled odds ratios (ORs) and 95% Article Title: Pillbox and patient-oriented manual interventions to improve medication knowledge, attitudes, and practices among older adults with multimorbidity in Shanghai, China. Article Snippet: AR TIC LE IN PR ES S ARTICLE IN PRESS All statistical analyses were performed using Sequencing:Article Title: Host immune responses to viral coinfection with Human papillomavirus (HPV)16/18 SARS-CoV-2 and HIV: an ex-vivo study. Article Snippet: HPV peptides used were manufactured by JPT Peptide Solutions (JPT Peptide Technologies GmbH) and the final concentration of the peptide used was 1ug/ml. .. The sequence for HPV 16 was MHQKRTAMFQDPQERPRKLPQLCTELQTTIHDIILECVYCKQQLLRREVYDFAFR DLCIVYRDGNPYAVCDKCLKFYSKISEYRHYCYSLYGTTLEQQYNKPLCDLLIRCI NCQKPLCPEEKQRHLDKKQRFHNIRGRWTGRCMSCCRSSRTRRETQL and HPV 18 MARFEDPTRR PYKLPDLCTE LNTSLQDIEI TCVYCKTVLE LTEVFEFAFK DLFVVYRDSI PHAACHKCID FYSRIRELRH YSDSVYGDTL EKLTNTGLYN LLIRCLRCQK PLNPAEKLRH LNEKRRFHNI AGHYRGQCHS CCNRARQERL QRRRETQV Statistical analysis: Data was analyzed using Construct:Article Title: Design and validation of a bioethical assessment instrument for public health policies involving behavioral change: A mixed-methods study Article Snippet: .. For the quantitative phase involving the Delphi technique, and based on the experts’ responses from both iterations, a database was constructed and analyzed using |